PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00585.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 291aa    MW: 31959.4 Da    PI: 5.2065
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00585.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.74.4e-17132180351
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                              ++kr rr+++NR++ArrsRqRK+++++ Le  v++L++ N++L k+l  
  Rsa1.0_00585.1_g00011.1 132 DVKRIRRMYSNRISARRSRQRKQEQLADLESQVDSLKGVNSTLYKQLID 180
                              68*****************************************988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.3E-13125185No hitNo description
SMARTSM003381.7E-14130194IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.358132178IPR004827Basic-leucine zipper domain
PfamPF001704.3E-14133178IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.1E-12133183No hitNo description
CDDcd147021.00E-17135186No hitNo description
PROSITE patternPS000360137152IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MDGHTGKDIG MKRSASELAL QELLTKFLSR QESILDTSPL DPSFDLMNWD YTCGELRDSL  60
LKSESLTPAR LFLDAQSSIC ENLSADSPVS ANKPEAKRAA RGTVSVYTDD HSDEEDAETE  120
AGQSEMTNDP NDVKRIRRMY SNRISARRSR QRKQEQLADL ESQVDSLKGV NSTLYKQLID  180
ATQQFRTAGT NNRVLKSDVE TLRVKVKLAE DLIARGSFTS SLNQLLQTHL SPPPSHSINS  240
LHYTGNNTSP GITVHSDQSL FPGITISGQN SSPGLGNVSS EAVSCVSDIW P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146152RRSRQRK
2146153RRSRQRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013678102.10.0PREDICTED: basic leucine zipper 9-like
RefseqXP_013700428.10.0PREDICTED: basic leucine zipper 9-like
SwissprotQ9FUD31e-161BZIP9_ARATH; Basic leucine zipper 9
TrEMBLM4DVC70.0M4DVC7_BRARP; Uncharacterized protein
STRINGBra020471.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-163basic leucine zipper 9